Lineage for d1rkja1 (1rkj A:5-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952022Protein Nucleolin [54952] (2 species)
  7. 2952023Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54953] (4 PDB entries)
  8. 2952028Domain d1rkja1: 1rkj A:5-91 [97613]
    Other proteins in same PDB: d1rkja3
    protein/RNA complex

Details for d1rkja1

PDB Entry: 1rkj (more details)

PDB Description: solution structure of the complex formed by the two n-terminal rna- binding domains of nucleolin and a pre-rrna target
PDB Compounds: (A:) Nucleolin

SCOPe Domain Sequences for d1rkja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkja1 d.58.7.1 (A:5-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
vegsesttpfnlfignlnpnksvaelkvaiselfakndlavvdvrtgtnrkfgyvdfesa
edlekaleltglkvfgneiklekpkgr

SCOPe Domain Coordinates for d1rkja1:

Click to download the PDB-style file with coordinates for d1rkja1.
(The format of our PDB-style files is described here.)

Timeline for d1rkja1: