Lineage for d1rkeb_ (1rke B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987801Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1987802Family a.24.9.1: alpha-catenin/vinculin [47221] (3 protein domains)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1987818Protein Vinculin [47224] (2 species)
  7. 1987832Species Human (Homo sapiens) [TaxId:9606] [101111] (15 PDB entries)
    Uniprot P18206 1-257
  8. 1987847Domain d1rkeb_: 1rke B: [97610]
    Other proteins in same PDB: d1rkea3
    tail domain; complexed with separate head domain of the same or closely related protein

Details for d1rkeb_

PDB Entry: 1rke (more details), 2.35 Å

PDB Description: Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
PDB Compounds: (B:) VCL protein

SCOPe Domain Sequences for d1rkeb_:

Sequence, based on SEQRES records: (download)

>d1rkeb_ a.24.9.1 (B:) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
deefpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggs
gtkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstv
katmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrk
tp

Sequence, based on observed residues (ATOM records): (download)

>d1rkeb_ a.24.9.1 (B:) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
deefpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggs
gtkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstv
katmldeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktp

SCOPe Domain Coordinates for d1rkeb_:

Click to download the PDB-style file with coordinates for d1rkeb_.
(The format of our PDB-style files is described here.)

Timeline for d1rkeb_: