SCOPe 2.07: Domain d1rkea2: 1rke A:129-258

Lineage for d1rkea2 (1rke A:129-258)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
   Uniprot P18206 1-257

8. Domain d1rkea2: 1rke A:129-258 [97609]
   Other proteins in same PDB: d1rkea3
   head domain; contains two domains of this fold; complexed with separate tail domain of the same or closely related protein

Details for d1rkea2

PDB Entry: 1rke, 2.35 Å

PDB Description: Human vinculin head (1-258) in complex with human vinculin tail (879-1066)

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d1rkea2:

Sequence; same for both SEQRES and ATOM records:

>d1rkea2 a.24.9.1 (A:129-258) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswdedaw

Timeline for d1rkea2:

• d1rkea2 first appeared in SCOP 1.67
  
• d1rkea2 appears in SCOPe 2.06
  
• d1rkea2 appears in the current release, SCOPe 2.08