| Class b: All beta proteins [48724] (141 folds) |
| Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.3: Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain [101931] (1 family) ![]() |
| Family b.72.3.1: Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain [101932] (1 protein) |
| Protein Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain [101933] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101934] (1 PDB entry) |
| Domain d1rk8c_: 1rk8 C: [97605] Other proteins in same PDB: d1rk8a_, d1rk8b_ complexed with ca |
PDB Entry: 1rk8 (more details), 1.9 Å
SCOP Domain Sequences for d1rk8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rk8c_ b.72.3.1 (C:) Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain {Fruit fly (Drosophila melanogaster)}
tylqssegkfipatkrpdgtwrkarrvkdgyvp
Timeline for d1rk8c_: