Lineage for d1rk8b_ (1rk8 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614156Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 2614157Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
    automatically mapped to Pfam PF02792
  5. 2614158Family d.232.1.1: Mago nashi protein [89818] (2 proteins)
  6. 2614159Protein Mago nashi protein [89819] (2 species)
  7. 2614160Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89820] (3 PDB entries)
  8. 2614162Domain d1rk8b_: 1rk8 B: [97604]
    Other proteins in same PDB: d1rk8a_, d1rk8c_
    protein/RNA complex; complexed with ca

Details for d1rk8b_

PDB Entry: 1rk8 (more details), 1.9 Å

PDB Description: structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
PDB Compounds: (B:) mago nashi protein

SCOPe Domain Sequences for d1rk8b_:

Sequence, based on SEQRES records: (download)

>d1rk8b_ d.232.1.1 (B:) Mago nashi protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
edfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkr
iiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcf
yylvqdlkclvfsliglhfki

Sequence, based on observed residues (ATOM records): (download)

>d1rk8b_ d.232.1.1 (B:) Mago nashi protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
edfylryyvgheflefefrpdgklryanmirkeafvhqsvmeelkriiidseimqeddlp
wpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcfyylvqdlkclvfsl
iglhfki

SCOPe Domain Coordinates for d1rk8b_:

Click to download the PDB-style file with coordinates for d1rk8b_.
(The format of our PDB-style files is described here.)

Timeline for d1rk8b_: