Lineage for d1rk8a_ (1rk8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952138Protein RNA-binding protein 8 [89938] (2 species)
  7. 2952139Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries)
    CG8781 protein
  8. 2952141Domain d1rk8a_: 1rk8 A: [97603]
    Other proteins in same PDB: d1rk8b_, d1rk8c_
    protein/RNA complex; complexed with ca

Details for d1rk8a_

PDB Entry: 1rk8 (more details), 1.9 Å

PDB Description: structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
PDB Compounds: (A:) CG8781-PA protein

SCOPe Domain Sequences for d1rk8a_:

Sequence, based on SEQRES records: (download)

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethk
qalaakealngaeimgqtiqvdwcfvkg

Sequence, based on observed residues (ATOM records): (download)

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pqrsvgwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkq
alaakealngaeimgqtiqvdwcfvkg

SCOPe Domain Coordinates for d1rk8a_:

Click to download the PDB-style file with coordinates for d1rk8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rk8a_: