Class b: All beta proteins [48724] (144 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.6: D-aminoacylase [82230] (1 protein) |
Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species) |
Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries) |
Domain d1rk6a1: 1rk6 A:7-61 [97599] Other proteins in same PDB: d1rk6a3 |
PDB Entry: 1rk6 (more details), 1.43 Å
SCOP Domain Sequences for d1rk6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rk6a1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis} pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvsp
Timeline for d1rk6a1: