Lineage for d1rk5a3 (1rk5 A:62-419)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572244Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 572427Family c.1.9.11: D-aminoacylase, catalytic domain [82264] (1 protein)
  6. 572428Protein N-acyl-D-aminoacid amidohydrolase, catalytic domain [82265] (1 species)
    contains small a/b subdomain inserted after strand 7; unusual for the superfamily metal coordination by Cys
  7. 572429Species Alcaligenes faecalis [TaxId:511] [82266] (8 PDB entries)
  8. 572436Domain d1rk5a3: 1rk5 A:62-419 [97598]
    Other proteins in same PDB: d1rk5a1, d1rk5a2
    complexed with act, cu, zn2; mutant

Details for d1rk5a3

PDB Entry: 1rk5 (more details), 1.8 Å

PDB Description: the d-aminoacylase mutant d366a in complex with 100mm cucl2

SCOP Domain Sequences for d1rk5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk5a3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis}
gfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldeggsf
rfarfsdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdalas
gaigistgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrigre
ldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvllag
rtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafgpt
migsaglphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaerg

SCOP Domain Coordinates for d1rk5a3:

Click to download the PDB-style file with coordinates for d1rk5a3.
(The format of our PDB-style files is described here.)

Timeline for d1rk5a3: