Lineage for d1rk5a1 (1rk5 A:7-61)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471748Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 471749Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 471845Family b.92.1.6: D-aminoacylase [82230] (1 protein)
  6. 471846Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species)
  7. 471847Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries)
  8. 471860Domain d1rk5a1: 1rk5 A:7-61 [97596]
    Other proteins in same PDB: d1rk5a3

Details for d1rk5a1

PDB Entry: 1rk5 (more details), 1.8 Å

PDB Description: the d-aminoacylase mutant d366a in complex with 100mm cucl2

SCOP Domain Sequences for d1rk5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk5a1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis}
pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvsp

SCOP Domain Coordinates for d1rk5a1:

Click to download the PDB-style file with coordinates for d1rk5a1.
(The format of our PDB-style files is described here.)

Timeline for d1rk5a1: