| Class b: All beta proteins [48724] (180 folds) |
| Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
| Family b.92.1.6: D-aminoacylase [82230] (1 protein) |
| Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species) |
| Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries) |
| Domain d1rk5a1: 1rk5 A:7-61 [97596] Other proteins in same PDB: d1rk5a3 complexed with act, cu, zn; mutant |
PDB Entry: 1rk5 (more details), 1.8 Å
SCOPe Domain Sequences for d1rk5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rk5a1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]}
pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvsp
Timeline for d1rk5a1: