SCOP 1.67: Domain d1rk4b2: 1rk4 B:22-91

Lineage for d1rk4b2 (1rk4 B:22-91)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)
   similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition

7. Species Human (Homo sapiens) [TaxId:9606] [69515] (4 PDB entries)

8. Domain d1rk4b2: 1rk4 B:22-91 [97595]
   Other proteins in same PDB: d1rk4a1, d1rk4b1
   oxidized form; adopts different all-alpha dimeric fold

Details for d1rk4b2

PDB Entry: 1rk4, 1.79 Å

PDB Description: Crystal Structure of a Soluble Dimeric Form of Oxidised CLIC1

SCOP Domain Sequences for d1rk4b2:

Sequence; same for both SEQRES and ATOM records:

>d1rk4b2 c.47.1.5 (B:22-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
gncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlpfllygtevhtdtnkie
efleavlcpp

Timeline for d1rk4b2:

• d1rk4b2 is new in SCOP 1.67
  
• d1rk4b2 appears in SCOP 1.69
  
• d1rk4b2 appears in the current release, SCOPe 2.08