Lineage for d1rk4b1 (1rk4 B:92-234)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996615Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 1996616Species Human (Homo sapiens) [TaxId:9606] [69034] (5 PDB entries)
  8. 1996620Domain d1rk4b1: 1rk4 B:92-234 [97594]
    Other proteins in same PDB: d1rk4a2, d1rk4b2
    oxidized form; N-domain adopts a different all-alpha dimeric fold

Details for d1rk4b1

PDB Entry: 1rk4 (more details), 1.79 Å

PDB Description: Crystal Structure of a Soluble Dimeric Form of Oxidised CLIC1
PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1rk4b1:

Sequence, based on SEQRES records: (download)

>d1rk4b1 a.45.1.1 (B:92-234) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielaye

Sequence, based on observed residues (ATOM records): (download)

>d1rk4b1 a.45.1.1 (B:92-234) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdgvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayaree
fastcpddeeielaye

SCOPe Domain Coordinates for d1rk4b1:

Click to download the PDB-style file with coordinates for d1rk4b1.
(The format of our PDB-style files is described here.)

Timeline for d1rk4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rk4b2