Lineage for d1rk4a2 (1rk4 A:22-91)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132063Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 2132064Species Human (Homo sapiens) [TaxId:9606] [69515] (4 PDB entries)
  8. 2132067Domain d1rk4a2: 1rk4 A:22-91 [97593]
    Other proteins in same PDB: d1rk4a1, d1rk4b1
    oxidized form; adopts different all-alpha dimeric fold

Details for d1rk4a2

PDB Entry: 1rk4 (more details), 1.79 Å

PDB Description: Crystal Structure of a Soluble Dimeric Form of Oxidised CLIC1
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1rk4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk4a2 c.47.1.5 (A:22-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
gncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlpfllygtevhtdtnkie
efleavlcpp

SCOPe Domain Coordinates for d1rk4a2:

Click to download the PDB-style file with coordinates for d1rk4a2.
(The format of our PDB-style files is described here.)

Timeline for d1rk4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rk4a1