SCOPe 2.05: Domain d1rk4a2: 1rk4 A:22-91

Lineage for d1rk4a2 (1rk4 A:22-91)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)
   similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition

7. Species Human (Homo sapiens) [TaxId:9606] [69515] (4 PDB entries)

8. Domain d1rk4a2: 1rk4 A:22-91 [97593]
   Other proteins in same PDB: d1rk4a1, d1rk4b1
   oxidized form; adopts different all-alpha dimeric fold

Details for d1rk4a2

PDB Entry: 1rk4, 1.79 Å

PDB Description: Crystal Structure of a Soluble Dimeric Form of Oxidised CLIC1

PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1rk4a2:

Sequence; same for both SEQRES and ATOM records:

>d1rk4a2 c.47.1.5 (A:22-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
gncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlpfllygtevhtdtnkie
efleavlcpp

Timeline for d1rk4a2:

• d1rk4a2 first appeared in SCOP 1.67
  
• d1rk4a2 appears in SCOPe 2.04
  
• d1rk4a2 appears in SCOPe 2.06
  
• d1rk4a2 appears in the current release, SCOPe 2.08