Lineage for d1rk3a_ (1rk3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009359Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2009387Species Norway rat (Rattus norvegicus) [TaxId:10116] [101432] (15 PDB entries)
  8. 2009400Domain d1rk3a_: 1rk3 A: [97591]
    complexed with vdx

Details for d1rk3a_

PDB Entry: 1rk3 (more details), 2.2 Å

PDB Description: crystal structure of the rat vitamin d receptor ligand binding domain complexed with 1,25-dihydroxyvitamin d3 and a synthetic peptide containing the nr2 box of drip 205
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d1rk3a_:

Sequence, based on SEQRES records: (download)

>d1rk3a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsmlphladl
vsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdy
kydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklve
aiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmk
ltplvlevfgn

Sequence, based on observed residues (ATOM records): (download)

>d1rk3a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmplsmlphladlvsysiqkvigfa
kmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskagh
tlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqt
yircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn

SCOPe Domain Coordinates for d1rk3a_:

Click to download the PDB-style file with coordinates for d1rk3a_.
(The format of our PDB-style files is described here.)

Timeline for d1rk3a_: