SCOPe 2.07: Domain d1rjwd1: 1rjw D:1-137,D:306-339

Lineage for d1rjwd1 (1rjw D:1-137,D:306-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Bacillus stearothermophilus [TaxId:1422] [101703] (1 PDB entry)

8. Domain d1rjwd1: 1rjw D:1-137,D:306-339 [97588]
   Other proteins in same PDB: d1rjwa2, d1rjwb2, d1rjwc2, d1rjwd2
   complexed with etf, zn

Details for d1rjwd1

PDB Entry: 1rjw, 2.35 Å

PDB Description: crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r

PDB Compounds: (D:) alcohol dehydrogenase

SCOPe Domain Sequences for d1rjwd1:

Sequence; same for both SEQRES and ATOM records:

>d1rjwd1 b.35.1.2 (D:1-137,D:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
aeycraaadyvvkipdnXtiievqplekinevfdrmlkgqingrvvltledk

Timeline for d1rjwd1:

• d1rjwd1 first appeared in SCOP 1.67
  
• d1rjwd1 appears in SCOPe 2.06
  
• d1rjwd1 appears in the current release, SCOPe 2.08