Lineage for d1rjwd1 (1rjw D:1-137,D:306-339)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373088Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 373089Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 373153Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 373171Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 373186Species Bacillus stearothermophilus [TaxId:1422] [101703] (1 PDB entry)
  8. 373190Domain d1rjwd1: 1rjw D:1-137,D:306-339 [97588]
    Other proteins in same PDB: d1rjwa2, d1rjwb2, d1rjwc2, d1rjwd2
    complexed with etf, zn

Details for d1rjwd1

PDB Entry: 1rjw (more details), 2.35 Å

PDB Description: crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r

SCOP Domain Sequences for d1rjwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjwd1 b.35.1.2 (D:1-137,D:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus}
mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
aeycraaadyvvkipdnXtiievqplekinevfdrmlkgqingrvvltledk

SCOP Domain Coordinates for d1rjwd1:

Click to download the PDB-style file with coordinates for d1rjwd1.
(The format of our PDB-style files is described here.)

Timeline for d1rjwd1: