![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [102123] (1 PDB entry) |
![]() | Domain d1rjwc2: 1rjw C:138-305 [97587] Other proteins in same PDB: d1rjwa1, d1rjwb1, d1rjwc1, d1rjwd1 complexed with etf, zn |
PDB Entry: 1rjw (more details), 2.35 Å
SCOPe Domain Sequences for d1rjwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjwc2 c.2.1.1 (C:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} lsfeeaapifcagvttykalkvtgakpgewvaiygigglghvavqyakamglnvvavdig deklelakelgadlvvnplkedaakfmkekvggvhaavvtavskpafqsaynsirrggac vlvglppeempipifdtvlngikiigsivgtrkdlqealqfaaegkvk
Timeline for d1rjwc2: