![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [101703] (1 PDB entry) |
![]() | Domain d1rjwb1: 1rjw B:1-137,B:306-339 [97584] Other proteins in same PDB: d1rjwa2, d1rjwb2, d1rjwc2, d1rjwd2 complexed with etf, zn |
PDB Entry: 1rjw (more details), 2.35 Å
SCOPe Domain Sequences for d1rjwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjwb1 b.35.1.2 (B:1-137,B:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy aeycraaadyvvkipdnXtiievqplekinevfdrmlkgqingrvvltledk
Timeline for d1rjwb1: