SCOP 1.71: Domain d1rjwb1: 1rjw B:1-137,B:306-339

Lineage for d1rjwb1 (1rjw B:1-137,B:306-339)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Bacillus stearothermophilus [TaxId:1422] [101703] (1 PDB entry)

8. Domain d1rjwb1: 1rjw B:1-137,B:306-339 [97584]
   Other proteins in same PDB: d1rjwa2, d1rjwb2, d1rjwc2, d1rjwd2

Details for d1rjwb1

PDB Entry: 1rjw, 2.35 Å

PDB Description: crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r

SCOP Domain Sequences for d1rjwb1:

Sequence; same for both SEQRES and ATOM records:

>d1rjwb1 b.35.1.2 (B:1-137,B:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus}
mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
aeycraaadyvvkipdnXtiievqplekinevfdrmlkgqingrvvltledk

Timeline for d1rjwb1:

• d1rjwb1 first appeared in SCOP 1.67
  
• d1rjwb1 appears in SCOP 1.69
  
• d1rjwb1 appears in SCOP 1.73
  
• d1rjwb1 appears in the current release, SCOPe 2.08