Lineage for d1rjwa2 (1rjw A:138-305)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387038Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (12 proteins)
    N-terminal all-beta domain defines family
  6. 387056Protein Alcohol dehydrogenase [51737] (9 species)
  7. 387071Species Bacillus stearothermophilus [TaxId:1422] [102123] (1 PDB entry)
  8. 387072Domain d1rjwa2: 1rjw A:138-305 [97583]
    Other proteins in same PDB: d1rjwa1, d1rjwb1, d1rjwc1, d1rjwd1

Details for d1rjwa2

PDB Entry: 1rjw (more details), 2.35 Å

PDB Description: crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r

SCOP Domain Sequences for d1rjwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus}
lsfeeaapifcagvttykalkvtgakpgewvaiygigglghvavqyakamglnvvavdig
deklelakelgadlvvnplkedaakfmkekvggvhaavvtavskpafqsaynsirrggac
vlvglppeempipifdtvlngikiigsivgtrkdlqealqfaaegkvk

SCOP Domain Coordinates for d1rjwa2:

Click to download the PDB-style file with coordinates for d1rjwa2.
(The format of our PDB-style files is described here.)

Timeline for d1rjwa2: