Lineage for d1rjta_ (1rjt A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498854Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 498855Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 498856Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 499035Protein Small inducible cytokine b11 (CXCL11/I-TAC) [102732] (1 species)
  7. 499036Species Human (Homo sapiens) [TaxId:9606] [102733] (1 PDB entry)
  8. 499037Domain d1rjta_: 1rjt A: [97581]

Details for d1rjta_

PDB Entry: 1rjt (more details)

PDB Description: nmr structure of cxc chemokine cxcl11/itac

SCOP Domain Sequences for d1rjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjta_ d.9.1.1 (A:) Small inducible cytokine b11 (CXCL11/I-TAC) {Human (Homo sapiens)}
fpmfkrgrclcigpgvkavkvadiekasimypsnncdkieviitlkenkgqrclnpkskq
arliikkverknf

SCOP Domain Coordinates for d1rjta_:

Click to download the PDB-style file with coordinates for d1rjta_.
(The format of our PDB-style files is described here.)

Timeline for d1rjta_: