![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.6: D-aminoacylase [82230] (1 protein) |
![]() | Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species) |
![]() | Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries) |
![]() | Domain d1rjra2: 1rjr A:420-480 [97579] Other proteins in same PDB: d1rjra3 complexed with act, zn; mutant |
PDB Entry: 1rjr (more details), 2.1 Å
SCOPe Domain Sequences for d1rjra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjra2 b.92.1.6 (A:420-480) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]} qvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvln r
Timeline for d1rjra2: