SCOPe 2.05: Domain d1rjjb_: 1rjj B:

Lineage for d1rjjb_ (1rjj B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
   automatically mapped to Pfam PF07876

6. Protein Hypothetical protein AT5G22580 [102957] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102958] (1 PDB entry)

8. Domain d1rjjb_: 1rjj B: [97570]

Details for d1rjjb_

PDB Entry: 1rjj

PDB Description: solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana

PDB Compounds: (B:) expressed protein

SCOPe Domain Sequences for d1rjjb_:

Sequence; same for both SEQRES and ATOM records:

>d1rjjb_ d.58.4.4 (B:) Hypothetical protein AT5G22580 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp

Timeline for d1rjjb_:

• d1rjjb_ first appeared in SCOP 1.67
  
• d1rjjb_ appears in SCOPe 2.04
  
• d1rjjb_ appears in SCOPe 2.06
  
• d1rjjb_ appears in the current release, SCOPe 2.08