![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (7 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.4: Plant stress-induced protein [89927] (2 proteins) |
![]() | Protein Hypothetical protein AT5G22580 [102957] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102958] (1 PDB entry) |
![]() | Domain d1rjjb_: 1rjj B: [97570] |
PDB Entry: 1rjj (more details)
SCOP Domain Sequences for d1rjjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjjb_ d.58.4.4 (B:) Hypothetical protein AT5G22580 {Thale cress (Arabidopsis thaliana)} matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp
Timeline for d1rjjb_: