Lineage for d1rjjb_ (1rjj B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412116Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (7 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 412142Family d.58.4.4: Plant stress-induced protein [89927] (2 proteins)
  6. 412148Protein Hypothetical protein AT5G22580 [102957] (1 species)
  7. 412149Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102958] (1 PDB entry)
  8. 412151Domain d1rjjb_: 1rjj B: [97570]

Details for d1rjjb_

PDB Entry: 1rjj (more details)

PDB Description: solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana

SCOP Domain Sequences for d1rjjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjjb_ d.58.4.4 (B:) Hypothetical protein AT5G22580 {Thale cress (Arabidopsis thaliana)}
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp

SCOP Domain Coordinates for d1rjjb_:

Click to download the PDB-style file with coordinates for d1rjjb_.
(The format of our PDB-style files is described here.)

Timeline for d1rjjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rjja_