SCOP 1.67: Domain d1rjja_: 1rjj A:

Lineage for d1rjja_ (1rjj A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (7 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.4: Plant stress-induced protein [89927] (2 proteins)

6. Protein Hypothetical protein AT5G22580 [102957] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102958] (1 PDB entry)

8. Domain d1rjja_: 1rjj A: [97569]

Details for d1rjja_

PDB Entry: 1rjj

PDB Description: solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana

SCOP Domain Sequences for d1rjja_:

Sequence; same for both SEQRES and ATOM records:

>d1rjja_ d.58.4.4 (A:) Hypothetical protein AT5G22580 {Thale cress (Arabidopsis thaliana)}
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp

Timeline for d1rjja_:

• d1rjja_ is new in SCOP 1.67
  
• d1rjja_ appears in SCOP 1.69
  
• d1rjja_ appears in the current release, SCOPe 2.08