Lineage for d1rjja_ (1rjj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949779Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
    automatically mapped to Pfam PF07876
  6. 2949816Protein Hypothetical protein AT5G22580 [102957] (1 species)
  7. 2949817Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102958] (1 PDB entry)
  8. 2949818Domain d1rjja_: 1rjj A: [97569]

Details for d1rjja_

PDB Entry: 1rjj (more details)

PDB Description: solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
PDB Compounds: (A:) expressed protein

SCOPe Domain Sequences for d1rjja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjja_ d.58.4.4 (A:) Hypothetical protein AT5G22580 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp

SCOPe Domain Coordinates for d1rjja_:

Click to download the PDB-style file with coordinates for d1rjja_.
(The format of our PDB-style files is described here.)

Timeline for d1rjja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rjjb_