Lineage for d1rjfb_ (1rjf B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399733Family c.66.1.37: Leucine carboxy methyltransferase Ppm1 [102569] (1 protein)
  6. 399734Protein Leucine carboxy methyltransferase Ppm1 [102570] (1 species)
    involved in the regulation of protein phosphatase 2a activity
  7. 399735Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102571] (4 PDB entries)
  8. 399743Domain d1rjfb_: 1rjf B: [97565]

Details for d1rjfb_

PDB Entry: 1rjf (more details), 2.25 Å

PDB Description: Structure of PPM1, a leucine carboxy methyltransferase involved in the regulation of protein phosphatase 2A activity

SCOP Domain Sequences for d1rjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjfb_ c.66.1.37 (B:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae)}
iiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkv
dkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphla
yvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlnditett
rlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrf
gaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlr
slqfldeleelkvmqthyilmkaqwhh

SCOP Domain Coordinates for d1rjfb_:

Click to download the PDB-style file with coordinates for d1rjfb_.
(The format of our PDB-style files is described here.)

Timeline for d1rjfb_: