Lineage for d1rjdb_ (1rjd B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490261Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 490262Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (39 families) (S)
  5. 490681Family c.66.1.37: Leucine carboxy methyltransferase Ppm1 [102569] (1 protein)
  6. 490682Protein Leucine carboxy methyltransferase Ppm1 [102570] (1 species)
    involved in the regulation of protein phosphatase 2a activity
  7. 490683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102571] (4 PDB entries)
  8. 490685Domain d1rjdb_: 1rjd B: [97559]

Details for d1rjdb_

PDB Entry: 1rjd (more details), 1.8 Å

PDB Description: Structure of PPM1, a leucine carboxy methyltransferase involved in the regulation of protein phosphatase 2A activity

SCOP Domain Sequences for d1rjdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjdb_ c.66.1.37 (B:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae)}
eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafg
kvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfph
layvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndite
ttrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpnd
rfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkr
lrslqfldeleelkvmqthyilmkaqwhh

SCOP Domain Coordinates for d1rjdb_:

Click to download the PDB-style file with coordinates for d1rjdb_.
(The format of our PDB-style files is described here.)

Timeline for d1rjdb_: