Lineage for d1rj9b2 (1rj9 B:89-295)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394266Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 394367Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 394378Species Thermus aquaticus [TaxId:271] [52665] (11 PDB entries)
  8. 394383Domain d1rj9b2: 1rj9 B:89-295 [97556]
    Other proteins in same PDB: d1rj9a1, d1rj9a2, d1rj9b1
    complexed with gcp, mg

Details for d1rj9b2

PDB Entry: 1rj9 (more details), 1.9 Å

PDB Description: structure of the heterodimer of the conserved gtpase domains of the signal recognition particle (ffh) and its receptor (ftsy)

SCOP Domain Sequences for d1rj9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj9b2 c.37.1.10 (B:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

SCOP Domain Coordinates for d1rj9b2:

Click to download the PDB-style file with coordinates for d1rj9b2.
(The format of our PDB-style files is described here.)

Timeline for d1rj9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rj9b1