![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [52665] (11 PDB entries) |
![]() | Domain d1rj9b2: 1rj9 B:89-295 [97556] Other proteins in same PDB: d1rj9a1, d1rj9a2, d1rj9b1 complexed with gcp, mg |
PDB Entry: 1rj9 (more details), 1.9 Å
SCOP Domain Sequences for d1rj9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rj9b2 c.37.1.10 (B:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus} earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy fagvsekpeglepfyperlagrilgmg
Timeline for d1rj9b2: