Lineage for d1rj9a2 (1rj9 A:96-303)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364310Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1364428Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)
  7. 1364435Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries)
  8. 1364439Domain d1rj9a2: 1rj9 A:96-303 [97554]
    Other proteins in same PDB: d1rj9a1, d1rj9b1, d1rj9b2
    complexed with gcp, mg

Details for d1rj9a2

PDB Entry: 1rj9 (more details), 1.9 Å

PDB Description: structure of the heterodimer of the conserved gtpase domains of the signal recognition particle (ffh) and its receptor (ftsy)
PDB Compounds: (A:) Signal Recognition Protein

SCOPe Domain Sequences for d1rj9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj9a2 c.37.1.10 (A:96-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
kpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkr
lsipviqgpegtdsaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiak
adpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkv
pikfvgvgegpddlqpfdpeafvealle

SCOPe Domain Coordinates for d1rj9a2:

Click to download the PDB-style file with coordinates for d1rj9a2.
(The format of our PDB-style files is described here.)

Timeline for d1rj9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rj9a1