SCOP 1.73: Domain d1rj9a2: 1rj9 A:96-303

Lineage for d1rj9a2 (1rj9 A:96-303)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)

7. Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries)

8. Domain d1rj9a2: 1rj9 A:96-303 [97554]
   Other proteins in same PDB: d1rj9a1, d1rj9b1, d1rj9b2
   complexed with gcp, mg

Details for d1rj9a2

PDB Entry: 1rj9, 1.9 Å

PDB Description: structure of the heterodimer of the conserved gtpase domains of the signal recognition particle (ffh) and its receptor (ftsy)

PDB Compounds: (A:) Signal Recognition Protein

SCOP Domain Sequences for d1rj9a2:

Sequence; same for both SEQRES and ATOM records:

>d1rj9a2 c.37.1.10 (A:96-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
kpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkr
lsipviqgpegtdsaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiak
adpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkv
pikfvgvgegpddlqpfdpeafvealle

Timeline for d1rj9a2:

• d1rj9a2 first appeared in SCOP 1.67
  
• d1rj9a2 appears in SCOP 1.71
  
• d1rj9a2 appears in SCOP 1.75
  
• d1rj9a2 appears in the current release, SCOPe 2.08