Lineage for d1rj8g_ (1rj8 G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2386922Protein Ectodysplasin A, Eda-a1 [101610] (1 species)
  7. 2386923Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)
  8. 2386929Domain d1rj8g_: 1rj8 G: [97552]

Details for d1rj8g_

PDB Entry: 1rj8 (more details), 2.23 Å

PDB Description: the crystal structure of tnf family member eda-a2
PDB Compounds: (G:) ectodysplasin-A isoform EDA-A2

SCOPe Domain Sequences for d1rj8g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj8g_ b.22.1.1 (G:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens) [TaxId: 9606]}
pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
sinmskhttffgairlgeap

SCOPe Domain Coordinates for d1rj8g_:

Click to download the PDB-style file with coordinates for d1rj8g_.
(The format of our PDB-style files is described here.)

Timeline for d1rj8g_: