SCOPe 2.01: Domain d1rj8e_: 1rj8 E:

Lineage for d1rj8e_ (1rj8 E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Ectodysplasin A, Eda-a1 [101610] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)

8. Domain d1rj8e_: 1rj8 E: [97550]

Details for d1rj8e_

PDB Entry: 1rj8, 2.23 Å

PDB Description: the crystal structure of tnf family member eda-a2

PDB Compounds: (E:) ectodysplasin-A isoform EDA-A2

SCOPe Domain Sequences for d1rj8e_:

Sequence; same for both SEQRES and ATOM records:

>d1rj8e_ b.22.1.1 (E:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens) [TaxId: 9606]}
pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
sinmskhttffgairlgeap

Timeline for d1rj8e_:

• d1rj8e_ first appeared in SCOP 1.67
  
• d1rj8e_ appears in SCOP 1.75
  
• d1rj8e_ appears in SCOPe 2.02
  
• d1rj8e_ appears in the current release, SCOPe 2.08