Lineage for d1rj8a_ (1rj8 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370769Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 370770Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 370771Family b.22.1.1: TNF-like [49843] (11 proteins)
  6. 370813Protein Ectodysplasin A, Eda-a1 [101610] (1 species)
  7. 370814Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)
  8. 370815Domain d1rj8a_: 1rj8 A: [97547]

Details for d1rj8a_

PDB Entry: 1rj8 (more details), 2.23 Å

PDB Description: the crystal structure of tnf family member eda-a2

SCOP Domain Sequences for d1rj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj8a_ b.22.1.1 (A:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens)}
pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
sinmskhttffgairlgeap

SCOP Domain Coordinates for d1rj8a_:

Click to download the PDB-style file with coordinates for d1rj8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rj8a_: