Lineage for d1rj7i_ (1rj7 I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2386922Protein Ectodysplasin A, Eda-a1 [101610] (1 species)
  7. 2386923Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)
  8. 2386937Domain d1rj7i_: 1rj7 I: [97542]

Details for d1rj7i_

PDB Entry: 1rj7 (more details), 2.3 Å

PDB Description: crystal structure of eda-a1
PDB Compounds: (I:) Ectodysplasin A

SCOPe Domain Sequences for d1rj7i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj7i_ b.22.1.1 (I:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens) [TaxId: 9606]}
qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
adisinmskhttffgairlgeap

SCOPe Domain Coordinates for d1rj7i_:

Click to download the PDB-style file with coordinates for d1rj7i_.
(The format of our PDB-style files is described here.)

Timeline for d1rj7i_: