Lineage for d1rj7e_ (1rj7 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2048774Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2048849Protein Ectodysplasin A, Eda-a1 [101610] (1 species)
  7. 2048850Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)
  8. 2048860Domain d1rj7e_: 1rj7 E: [97538]

Details for d1rj7e_

PDB Entry: 1rj7 (more details), 2.3 Å

PDB Description: crystal structure of eda-a1
PDB Compounds: (E:) Ectodysplasin A

SCOPe Domain Sequences for d1rj7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj7e_ b.22.1.1 (E:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens) [TaxId: 9606]}
gtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgty
fiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkia
vkmvhadisinmskhttffgairlgeapa

SCOPe Domain Coordinates for d1rj7e_:

Click to download the PDB-style file with coordinates for d1rj7e_.
(The format of our PDB-style files is described here.)

Timeline for d1rj7e_: