Lineage for d1rj7b_ (1rj7 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555454Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 555455Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 555456Family b.22.1.1: TNF-like [49843] (12 proteins)
  6. 555511Protein Ectodysplasin A, Eda-a1 [101610] (1 species)
  7. 555512Species Human (Homo sapiens) [TaxId:9606] [101611] (2 PDB entries)
  8. 555520Domain d1rj7b_: 1rj7 B: [97536]

Details for d1rj7b_

PDB Entry: 1rj7 (more details), 2.3 Å

PDB Description: crystal structure of eda-a1

SCOP Domain Sequences for d1rj7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj7b_ b.22.1.1 (B:) Ectodysplasin A, Eda-a1 {Human (Homo sapiens)}
qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
adisinmskhttffgairlgeapa

SCOP Domain Coordinates for d1rj7b_:

Click to download the PDB-style file with coordinates for d1rj7b_.
(The format of our PDB-style files is described here.)

Timeline for d1rj7b_: