Lineage for d1rj6a_ (1rj6 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676371Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 676372Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 676373Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 676374Protein Carbonic anhydrase [51071] (10 species)
  7. 676618Species Mouse (Mus musculus), isozyme XIV [TaxId:10090] [101945] (2 PDB entries)
  8. 676619Domain d1rj6a_: 1rj6 A: [97533]

Details for d1rj6a_

PDB Entry: 1rj6 (more details), 2.9 Å

PDB Description: crystal structure of the extracellular domain of murine carbonic anhydrase xiv in complex with acetazolamide
PDB Compounds: (A:) Carbonic anhydrase XIV

SCOP Domain Sequences for d1rj6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]}
hhwtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldl
hnnghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhy
dsqsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvr
elfpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpsepl
vqnyrvpqplnqrtifasf

SCOP Domain Coordinates for d1rj6a_:

Click to download the PDB-style file with coordinates for d1rj6a_.
(The format of our PDB-style files is described here.)

Timeline for d1rj6a_: