SCOP 1.71: Domain d1rj4b_: 1rj4 B:

Lineage for d1rj4b_ (1rj4 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.29: Bromodomain-like [47363] (6 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (2 proteins)
   Pfam 04043

6. Protein Invertase inhibitor [101150] (1 species)

7. Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (2 PDB entries)

8. Domain d1rj4b_: 1rj4 B: [97528]

Details for d1rj4b_

PDB Entry: 1rj4, 2 Å

PDB Description: Structure of a Cell Wall Invertase Inhibitor from Tobacco in Complex with Cd2+

SCOP Domain Sequences for d1rj4b_:

Sequence; same for both SEQRES and ATOM records:

>d1rj4b_ a.29.6.1 (B:) Invertase inhibitor {Common tobacco (Nicotiana tabacum)}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnll

Timeline for d1rj4b_:

• d1rj4b_ first appeared in SCOP 1.67
  
• d1rj4b_ appears in SCOP 1.69
  
• d1rj4b_ appears in SCOP 1.73
  
• d1rj4b_ appears in the current release, SCOPe 2.08