![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (6 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family) ![]() contains a short alpha-hairpin at the N-terminal extension |
![]() | Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (1 protein) Pfam 04043 |
![]() | Protein Invertase inhibitor [101150] (1 species) |
![]() | Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (2 PDB entries) |
![]() | Domain d1rj4b_: 1rj4 B: [97528] |
PDB Entry: 1rj4 (more details), 2 Å
SCOP Domain Sequences for d1rj4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rj4b_ a.29.6.1 (B:) Invertase inhibitor {Common tobacco (Nicotiana tabacum)} nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs kspfsalniavhelsdvgraivrnll
Timeline for d1rj4b_: