Lineage for d1rj4b_ (1rj4 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354724Fold a.29: Bromodomain-like [47363] (5 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 354808Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 354809Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (1 protein)
    Pfam 04043
  6. 354810Protein Invertase inhibitor [101150] (1 species)
  7. 354811Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (2 PDB entries)
  8. 354814Domain d1rj4b_: 1rj4 B: [97528]

Details for d1rj4b_

PDB Entry: 1rj4 (more details), 2 Å

PDB Description: Structure of a Cell Wall Invertase Inhibitor from Tobacco in Complex with Cd2+

SCOP Domain Sequences for d1rj4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj4b_ a.29.6.1 (B:) Invertase inhibitor {Common tobacco (Nicotiana tabacum)}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnll

SCOP Domain Coordinates for d1rj4b_:

Click to download the PDB-style file with coordinates for d1rj4b_.
(The format of our PDB-style files is described here.)

Timeline for d1rj4b_: