SCOP 1.69: Domain d1rj1a_: 1rj1 A:

Lineage for d1rj1a_ (1rj1 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.29: Bromodomain-like [47363] (6 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (1 protein)
   Pfam 04043

6. Protein Invertase inhibitor [101150] (1 species)

7. Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (2 PDB entries)

8. Domain d1rj1a_: 1rj1 A: [97526]

Details for d1rj1a_

PDB Entry: 1rj1, 1.87 Å

PDB Description: Crystal Structure of a Cell Wall Invertase Inhibitor from Tobacco

SCOP Domain Sequences for d1rj1a_:

Sequence; same for both SEQRES and ATOM records:

>d1rj1a_ a.29.6.1 (A:) Invertase inhibitor {Common tobacco (Nicotiana tabacum)}
gnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrh
snppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfk
gskspfsalniavhelsdvgraivrnll

Timeline for d1rj1a_:

• d1rj1a_ first appeared in SCOP 1.67
  
• d1rj1a_ appears in SCOP 1.71
  
• d1rj1a_ appears in the current release, SCOPe 2.08, called d1rj1a1