Lineage for d1rj1a1 (1rj1 A:1-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708802Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 2708803Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
    Pfam PF04043
  6. 2708804Protein Invertase inhibitor [101150] (1 species)
  7. 2708805Species Tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (2 PDB entries)
  8. 2708806Domain d1rj1a1: 1rj1 A:1-147 [97526]
    Other proteins in same PDB: d1rj1a2

Details for d1rj1a1

PDB Entry: 1rj1 (more details), 1.87 Å

PDB Description: Crystal Structure of a Cell Wall Invertase Inhibitor from Tobacco
PDB Compounds: (A:) invertase inhibitor

SCOPe Domain Sequences for d1rj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj1a1 a.29.6.1 (A:1-147) Invertase inhibitor {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

SCOPe Domain Coordinates for d1rj1a1:

Click to download the PDB-style file with coordinates for d1rj1a1.
(The format of our PDB-style files is described here.)

Timeline for d1rj1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rj1a2