SCOPe 2.08: Domain d1rj1a1: 1rj1 A:1-147

Lineage for d1rj1a1 (1rj1 A:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
   Pfam PF04043

6. Protein Invertase inhibitor [101150] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (2 PDB entries)

8. Domain d1rj1a1: 1rj1 A:1-147 [97526]
   Other proteins in same PDB: d1rj1a2

Details for d1rj1a1

PDB Entry: 1rj1, 1.87 Å

PDB Description: Crystal Structure of a Cell Wall Invertase Inhibitor from Tobacco

PDB Compounds: (A:) invertase inhibitor

SCOPe Domain Sequences for d1rj1a1:

Sequence; same for both SEQRES and ATOM records:

>d1rj1a1 a.29.6.1 (A:1-147) Invertase inhibitor {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

Timeline for d1rj1a1:

• d1rj1a1 first appeared in SCOP 1.67, called d1rj1a_
  
• d1rj1a1 appears in SCOPe 2.07