SCOP 1.71: Domain d1rivh1: 1riv H:1-113

Lineage for d1rivh1 (1riv H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)

8. Domain d1rivh1: 1riv H:1-113 [97522]
   Other proteins in same PDB: d1rivh2, d1rivl1, d1rivl2
   part of anti-cocaine Fab M82G2
   complexed with obe

Details for d1rivh1

PDB Entry: 1riv, 2.2 Å

PDB Description: Anti-Cocaine Antibody M82G2 Complexed With meta-Oxybenzoylecgonine

SCOP Domain Sequences for d1rivh1:

Sequence; same for both SEQRES and ATOM records:

>d1rivh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
a

Timeline for d1rivh1:

• d1rivh1 first appeared in SCOP 1.67
  
• d1rivh1 appears in SCOP 1.69
  
• d1rivh1 appears in SCOP 1.73
  
• d1rivh1 appears in the current release, SCOPe 2.08