Lineage for d1rivh1 (1riv H:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451027Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)
  8. 451046Domain d1rivh1: 1riv H:1-113 [97522]
    Other proteins in same PDB: d1rivh2, d1rivl1, d1rivl2
    part of anti-cocaine Fab M82G2

Details for d1rivh1

PDB Entry: 1riv (more details), 2.2 Å

PDB Description: Anti-Cocaine Antibody M82G2 Complexed With meta-Oxybenzoylecgonine

SCOP Domain Sequences for d1rivh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rivh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
a

SCOP Domain Coordinates for d1rivh1:

Click to download the PDB-style file with coordinates for d1rivh1.
(The format of our PDB-style files is described here.)

Timeline for d1rivh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rivh2