SCOPe 2.06: Domain d1riqa2: 1riq A:1-236

Lineage for d1riqa2 (1riq A:1-236)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries)

8. Domain d1riqa2: 1riq A:1-236 [97517]
   Other proteins in same PDB: d1riqa1, d1riqa3

Details for d1riqa2

PDB Entry: 1riq, 2.14 Å

PDB Description: The crystal structure of the catalytic fragment of the alanyl-tRNA synthetase

PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1riqa2:

Sequence; same for both SEQRES and ATOM records:

>d1riqa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

Timeline for d1riqa2:

• d1riqa2 first appeared in SCOP 1.67
  
• d1riqa2 appears in SCOPe 2.05
  
• d1riqa2 appears in SCOPe 2.07
  
• d1riqa2 appears in the current release, SCOPe 2.08