Lineage for d1riqa2 (1riq A:1-236)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins) 
Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species) Species Aquifex aeolicus [TaxId:63363] [103156] (1 PDB entry) 
Domain d1riqa2: 1riq A:1-236 [97517]
Other proteins in same PDB: d1riqa1
Details for d1riqa2
PDB Entry: 1riq (more details), 2.14 Å
PDB Description: The crystal structure of the catalytic fragment of the alanyl-tRNA synthetase
SCOP Domain Sequences for d1riqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1riqa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf
SCOP Domain Coordinates for d1riqa2:
Click to download the PDB-style file with coordinates for d1riqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1riqa2:
- d1riqa2 is new in SCOP 1.67
- d1riqa2 appears in SCOP 1.69
- d1riqa2 appears in the current release, SCOPe 2.08
View in 3D
