SCOPe 2.02: Domain d1riqa1: 1riq A:237-457

Lineage for d1riqa1 (1riq A:237-457)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.203: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101352] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.203.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101353] (1 family)

5. Family a.203.1.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101354] (1 protein)

6. Protein Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101355] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [101356] (5 PDB entries)

8. Domain d1riqa1: 1riq A:237-457 [97516]
   Other proteins in same PDB: d1riqa2

Details for d1riqa1

PDB Entry: 1riq, 2.14 Å

PDB Description: The crystal structure of the catalytic fragment of the alanyl-tRNA synthetase

PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1riqa1:

Sequence, based on SEQRES records:

>d1riqa1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhfkveakkvkpvyshlkelgktsafvgaaal

Sequence, based on observed residues (ATOM records):

>d1riqa1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhpvyshlkelgktsafvgaaal

Timeline for d1riqa1:

• d1riqa1 first appeared in SCOP 1.67
  
• d1riqa1 appears in SCOPe 2.01
  
• d1riqa1 appears in SCOPe 2.03
  
• d1riqa1 appears in the current release, SCOPe 2.08