Lineage for d1riqa1 (1riq A:237-457)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362550Fold a.203: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101352] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 362551Superfamily a.203.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101353] (1 family) (S)
  5. 362552Family a.203.1.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101354] (1 protein)
  6. 362553Protein Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101355] (1 species)
  7. 362554Species Aquifex aeolicus [TaxId:63363] [101356] (1 PDB entry)
  8. 362555Domain d1riqa1: 1riq A:237-457 [97516]
    Other proteins in same PDB: d1riqa2

Details for d1riqa1

PDB Entry: 1riq (more details), 2.14 Å

PDB Description: The crystal structure of the catalytic fragment of the alanyl-tRNA synthetase

SCOP Domain Sequences for d1riqa1:

Sequence, based on SEQRES records: (download)

>d1riqa1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhfkveakkvkpvyshlkelgktsafvgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1riqa1 a.203.1.1 (A:237-457) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhpvyshlkelgktsafvgaaal

SCOP Domain Coordinates for d1riqa1:

Click to download the PDB-style file with coordinates for d1riqa1.
(The format of our PDB-style files is described here.)

Timeline for d1riqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1riqa2